PDB entry 3iq3

View 3iq3 on RCSB PDB site
Description: Crystal Structure of Bothropstoxin-I complexed with polietilene glicol 4000 - crystallized at 283 K
Class: Toxin
Keywords: Homologue Phospholipase A2, Bothropstoxin-I, BthTX-I_10C, Lys49-PLA2 from Bothrops jararacussu, Snake venom, Antibiotic, Antimicrobial, Disulfide bond, Myotoxin, Secreted, Toxin
Deposited on 2009-08-19, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.203
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog bothropstoxin-1
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90249 (0-120)
      • see remark 999 (57)
    Domains in SCOPe 2.07: d3iq3a_
  • Chain 'B':
    Compound: Phospholipase A2 homolog bothropstoxin-1
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90249 (0-120)
      • see remark 999 (57)
    Domains in SCOPe 2.07: d3iq3b_
  • Heterogens: PE4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3iq3A (A:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3iq3B (B:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c