PDB entry 3ioq

View 3ioq on RCSB PDB site
Description: Crystal structure of the Carica candamarcensis cysteine protease CMS1MS2 in complex with E-64.
Class: hydrolase
Keywords: Caricaceae, cysteine protease, E-64, papain family, HYDROLASE
Deposited on 2009-08-14, released 2010-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cms1ms2
    Species: Carica candamarcensis [TaxId:35926]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IOQ (0-212)
    Domains in SCOPe 2.08: d3ioqa_
  • Heterogens: E64, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ioqA (A:)
    iptsidwrqkgavtpvrnqggcgscwtfssvaaveginkivtgqllslseqelldcerrs
    ygcrggfplyalqyvansgihlrqyypyegvqrqcrasqakgpkvktdgvgrvprnneqa
    liqriaiqpvsivveakgrafqnyrggifagpcgtsidhavaavgygndyiliknswgtg
    wgeggyirikrgsgnpqgacgvlsdsvfptknr