PDB entry 3iof

View 3iof on RCSB PDB site
Description: Crystal structure of CphA N220G mutant with inhibitor 10a
Class: Hydrolase
Keywords: Hydrolase, Antibiotic resistance, Metal-binding
Deposited on 2009-08-14, released 2010-06-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.124
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: cphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26918 (0-226)
      • engineered mutation (164)
    Domains in SCOPe 2.01: d3iofa_
  • Heterogens: ZN, IFS, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3iofA (A:)
    agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
    vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
    vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
    kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqs