PDB entry 3inz

View 3inz on RCSB PDB site
Description: H57T Hfq from Pseudomonas aeruginosa
Class: RNA-binding protein
Keywords: Hfq, protein tertiary structure, RNA-binding, Stress response, RNA-BINDING PROTEIN
Deposited on 2009-08-13, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.153
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUM0
      • engineered (56)
    Domains in SCOPe 2.07: d3inza_
  • Chain 'B':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUM0
      • engineered (56)
    Domains in SCOPe 2.07: d3inzb_
  • Chain 'C':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUM0
      • engineered (56)
    Domains in SCOPe 2.07: d3inzc_
  • Chain 'D':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUM0
      • engineered (56)
    Domains in SCOPe 2.07: d3inzd_
  • Chain 'E':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUM0
      • engineered (56)
    Domains in SCOPe 2.07: d3inze_
  • Chain 'F':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUM0
      • engineered (56)
    Domains in SCOPe 2.07: d3inzf_
  • Heterogens: CD, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3inzA (A:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >3inzA (A:)
    kghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktaistv
    vpsrpvrlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3inzB (B:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >3inzB (B:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktaistvvp
    srpvrlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3inzC (C:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >3inzC (C:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktaistvvp
    srpvrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3inzD (D:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >3inzD (D:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktaistvvp
    srpvrlp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3inzE (E:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >3inzE (E:)
    kghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktaistv
    vpsrpvrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3inzF (F:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >3inzF (F:)
    ghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktaistvv
    psrpvrlpsgd