PDB entry 3ins

View 3ins on RCSB PDB site
Description: structure of insulin. results of joint neutron and x-ray refinement
Deposited on 1988-10-14, released 1989-01-09
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: NEUT;XRAY
Resolution: 1.5 Å
R-factor: 0.182
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3ins.1
  • Chain 'B':
    Domains in SCOP 1.55: d3ins.1
  • Chain 'C':
    Domains in SCOP 1.55: d3ins.2
  • Chain 'D':
    Domains in SCOP 1.55: d3ins.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3insA (A:)
giveqcctsicslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3insB (B:)
fvnqhlcgshlvealylvcgergffytpka

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3insC (C:)
giveqcctsicslyqlenycn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3insD (D:)
fvnqhlcgshlvealylvcgergffytpka