PDB entry 3ine

View 3ine on RCSB PDB site
Description: Bace1 with the aminohydantoin Compound S-34
Class: hydrolase
Keywords: Bace1, xray, inhibitor, Alternative splicing, Aspartyl protease, Disulfide bond, Glycoprotein, Hydrolase, Membrane, Polymorphism, Protease, Transmembrane, Zymogen
Deposited on 2009-08-12, released 2010-03-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.222
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1, BACE, KIAA1149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3inea_
  • Heterogens: X17, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ineA (A:)
    etdeepeepgrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaap
    hpflhryyqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaite
    sdkffingsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqs
    evlasvggsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydk
    sivdsgttnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvis
    lylmgevtnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvv
    fdrarkrigfavsachvhdefrtaavegpfvtldmedcgynipqtdesthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ineA (A:)
    sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
    styrdlrkgvyvpytkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegil
    glayaeiarpddslepffdslvkqthvpnlfslqlcgagflasvggsmiiggidhslytg
    slwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavk
    sikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqyl
    rpcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegpfvt
    medcgyn