PDB entry 3in2

View 3in2 on RCSB PDB site
Description: Crystal structure of the N47S/M121L variant of Pseudomonas aeruginosa azurin in the Cu(II) state
Class: electron transport
Keywords: CUPREDOXIN, AZURIN, GREEK KEY, BETA BARREL, ELECTRON TRANSFER, Copper, Disulfide bond, Electron transport, Metal-binding, Periplasm, Transport
Deposited on 2009-08-11, released 2009-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.238
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (46)
      • engineered (120)
    Domains in SCOPe 2.03: d3in2a_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3in2A (A:)
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghswvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
lkgtltlk