PDB entry 3in0

View 3in0 on RCSB PDB site
Description: Crystal structure of the F114P/M121Q variant of Pseudomonas aeruginosa azurin in the Cu(II) state
Class: electron transport
Keywords: CUPREDOXIN, AZURIN, GREEK KEY, BETA BARREL, ELECTRON TRANSFER, Copper, Disulfide bond, Electron transport, Metal-binding, Periplasm, Transport
Deposited on 2009-08-11, released 2009-10-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.253
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (113)
      • engineered (120)
    Domains in SCOPe 2.06: d3in0a_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (113)
      • engineered (120)
    Domains in SCOPe 2.06: d3in0b_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (113)
      • engineered (120)
    Domains in SCOPe 2.06: d3in0c_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (113)
      • engineered (120)
    Domains in SCOPe 2.06: d3in0d_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3in0A (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctppghsal
    qkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3in0B (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctppghsal
    qkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3in0C (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctppghsal
    qkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3in0D (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctppghsal
    qkgtltlk