PDB entry 3imr

View 3imr on RCSB PDB site
Description: Transthyretin in complex with (E)-2,6-dibromo-4-(2,6-dichlorostyryl)phenol
Class: hormone
Keywords: Hormone, Growth Factor, Amyloid, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Polymorphism, Polyneuropathy, Retinol-binding, Secreted, Thyroid hormone, Transport, Vitamin A
Deposited on 2009-08-11, released 2010-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, Transthyretin, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3imra_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, Transthyretin, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3imrb_
  • Heterogens: IW1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3imrA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3imrA (A:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3imrB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3imrB (B:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn