PDB entry 3imf

View 3imf on RCSB PDB site
Description: 1.99 Angstrom resolution crystal structure of a short chain dehydrogenase from Bacillus anthracis str. 'Ames Ancestor'
Class: oxidoreductase
Keywords: Short Chain Dehydrogenase, Structural Genomics, Infectious Diseases, Center for Structural Genomics of Infectious Diseases, Oxidoreductase, CSGID
Deposited on 2009-08-10, released 2009-08-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.168
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short chain dehydrogenase
    Species: Bacillus anthracis str. 'Ames Ancestor' [TaxId:261594]
    Gene: BAS3900, BA_4204, GBAA4204, GBAA_4204, YP_020848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81MP2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3imfa_
  • Chain 'B':
    Compound: Short chain dehydrogenase
    Species: Bacillus anthracis str. 'Ames Ancestor' [TaxId:261594]
    Gene: BAS3900, BA_4204, GBAA4204, GBAA_4204, YP_020848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81MP2 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.05: d3imfb_
  • Chain 'C':
    Compound: Short chain dehydrogenase
    Species: Bacillus anthracis str. 'Ames Ancestor' [TaxId:261594]
    Gene: BAS3900, BA_4204, GBAA4204, GBAA_4204, YP_020848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81MP2 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.05: d3imfc_
  • Chain 'D':
    Compound: Short chain dehydrogenase
    Species: Bacillus anthracis str. 'Ames Ancestor' [TaxId:261594]
    Gene: BAS3900, BA_4204, GBAA4204, GBAA_4204, YP_020848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81MP2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3imfd_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3imfA (A:)
    snamkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltv
    qmdvrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfy
    csqaigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygi
    rvnaiapgpiertggadklwiseemakrtiqsvplgrlgtpeeiaglayylcsdeaayin
    gtcmtmdggqhlhqypf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3imfA (A:)
    namkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvq
    mdvrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfyc
    sqaigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygir
    vnaiapgpiertggaemakrtiqsvplgrlgtpeeiaglayylcsdeaayingtcmtmdg
    gqhlhqyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3imfB (B:)
    snamkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltv
    qmdvrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfy
    csqaigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygi
    rvnaiapgpiertggadklwiseemakrtiqsvplgrlgtpeeiaglayylcsdeaayin
    gtcmtmdggqhlhqypf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3imfB (B:)
    amkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvqm
    dvrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfycs
    qaigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygirv
    naiapgpiertggadeemakrtiqsvplgrlgtpeeiaglayylcsdeaayingtcmtmd
    ggqhlhqyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3imfC (C:)
    snamkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltv
    qmdvrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfy
    csqaigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygi
    rvnaiapgpiertggadklwiseemakrtiqsvplgrlgtpeeiaglayylcsdeaayin
    gtcmtmdggqhlhqypf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3imfC (C:)
    amkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvqm
    dvrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfycs
    qaigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygirv
    naiapgpierakrtiqsvplgrlgtpeeiaglayylcsdeaayingtcmtmdggqhlhqy
    p
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3imfD (D:)
    snamkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltv
    qmdvrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfy
    csqaigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygi
    rvnaiapgpiertggadklwiseemakrtiqsvplgrlgtpeeiaglayylcsdeaayin
    gtcmtmdggqhlhqypf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3imfD (D:)
    namkekvviitggssgmgkgmatrfakegarvvitgrtkekleeakleieqfpgqiltvq
    mdvrntddiqkmieqidekfgridilinnaagnficpaedlsvngwnsvinivlngtfyc
    sqaigkywiekgikgniinmvatyawdagpgvihsaaakagvlamtktlavewgrkygir
    vnaiapgpiertggaemakrtiqsvplgrlgtpeeiaglayylcsdeaayingtcmtmdg
    gqhlhqyp