PDB entry 3im3

View 3im3 on RCSB PDB site
Description: Crystal structure of PKA RI alpha dimerization/docking domain
Class: structural protein, signaling protein
Keywords: helix-turn-helix, Acetylation, cAMP, cAMP-binding, Disulfide bond, Nucleotide-binding, Phosphoprotein, STRUCTURAL PROTEIN, SIGNALING PROTEIN
Deposited on 2009-08-09, released 2010-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKAR1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3im3a_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3im3A (A:)
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak