PDB entry 3iln

View 3iln on RCSB PDB site
Description: X-ray structure of the laminarinase from Rhodothermus marinus
Class: hydrolase
Keywords: jelly row, hydrolase, family 16 glycosyl hydrolase
Deposited on 2009-08-07, released 2010-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.159
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Laminarinase
    Species: Rhodothermus marinus [TaxId:29549]
    Gene: lamR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52754 (0-250)
      • engineered (126)
    Domains in SCOPe 2.06: d3ilna_
  • Chain 'B':
    Compound: Laminarinase
    Species: Rhodothermus marinus [TaxId:29549]
    Gene: lamR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52754 (0-250)
      • engineered (126)
    Domains in SCOPe 2.06: d3ilnb_
  • Heterogens: GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ilnA (A:)
    rlphwelvwsdefdynglpdpakwdydvgghgwgnqelqyytrarienarvgggvliiea
    rresyegreytsarlvtrgkaswtygrfeirarlpsgrgtwpaiwmlpdrqtygsaywpd
    ngeidiaehvgfnpdvvhgtvhtkaynhllgtqrggsirvptartdfhvyaiewtpeeir
    wfvddslyyrfpnerltnpeadwrhwpfdqpfhlimniavggtwggqqgvdpeafpaqlv
    vdyvrvyrwve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ilnB (B:)
    rlphwelvwsdefdynglpdpakwdydvgghgwgnqelqyytrarienarvgggvliiea
    rresyegreytsarlvtrgkaswtygrfeirarlpsgrgtwpaiwmlpdrqtygsaywpd
    ngeidiaehvgfnpdvvhgtvhtkaynhllgtqrggsirvptartdfhvyaiewtpeeir
    wfvddslyyrfpnerltnpeadwrhwpfdqpfhlimniavggtwggqqgvdpeafpaqlv
    vdyvrvyrwve