PDB entry 3il8

View 3il8 on RCSB PDB site
Description: crystal structure of interleukin 8: symbiosis of nmr and crystallography
Deposited on 1990-12-07, released 1992-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1992-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3il8__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3il8_ (-)
    lrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvvek
    flkraens