PDB entry 3ikl

View 3ikl on RCSB PDB site
Description: Crystal structure of Pol gB delta-I4.
Class: transferase
Keywords: transferase
Deposited on 2009-08-06, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase subunit gamma-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: POLG2, MTPOLB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHN1 (Start-145)
      • linker (146-147)
    • Uniprot Q9UHN1 (147-452)
    Domains in SCOPe 2.07: d3ikla1
  • Chain 'B':
    Compound: DNA polymerase subunit gamma-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: POLG2, MTPOLB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHN1 (Start-145)
      • linker (146-147)
    • Uniprot Q9UHN1 (147-452)
    Domains in SCOPe 2.07: d3iklb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iklA (A:)
    mrsrvavrachkvcrcllsgfggrvdagqpelltersspkgghvkshaelegngehpeap
    gsgegsealleicqrrhflsgskqqlsrdsllsgchpgfgplgvelrknlaaewwtsvvv
    freqvfpvdalhhkpgpllpgdsafrgglrenllhgalehyvncldlvnkrlpyglaqig
    vcfhpvfdtkqirngvksigekteaslvwftpprtsnqwldfwlrhrlqwwrkfamspsn
    fsssdcqdeegrkgnklyynfpwgkelietlwnlgdhellhmypgnvsklhgrdgrknvv
    pcvlsvngdldrgmlaylydsfqltensftrkknlhrkvlklhpclapikvaldvgrgpt
    lelrqvcqglfnellengisvwpgyletmqssleqlyskydemsilftvlvtettlengl
    ihlrsrdttmkemmhisklkdflikyissaknvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iklA (A:)
    sealleicqrrhflsgskqqlsrdsllsgchpgfgplgvelrknlaaewwtsvvvfreqv
    fpvdalhhkpgpllpgdsafrggrenllhgalehyvncldlvnkrlpyglaqigvcfhpv
    ksigekteaslvwftpprtsnqwldfwlrhrlqwwrkfamspsnfsssdcqdeegrkgnk
    lyynfpwgkelietlwnlgdhellhmypgnvsklhgrdgrknvvpcvlsvngdldrgmla
    ylydsfqrkvlklhpclapikvaldvgrgptlelrqvcqglfnellengisvwpgyletm
    qssleqlyskydemsilftvlvtettlenglihlrsrdttmkemmhisklkdflikyiss
    aknv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iklB (B:)
    mrsrvavrachkvcrcllsgfggrvdagqpelltersspkgghvkshaelegngehpeap
    gsgegsealleicqrrhflsgskqqlsrdsllsgchpgfgplgvelrknlaaewwtsvvv
    freqvfpvdalhhkpgpllpgdsafrgglrenllhgalehyvncldlvnkrlpyglaqig
    vcfhpvfdtkqirngvksigekteaslvwftpprtsnqwldfwlrhrlqwwrkfamspsn
    fsssdcqdeegrkgnklyynfpwgkelietlwnlgdhellhmypgnvsklhgrdgrknvv
    pcvlsvngdldrgmlaylydsfqltensftrkknlhrkvlklhpclapikvaldvgrgpt
    lelrqvcqglfnellengisvwpgyletmqssleqlyskydemsilftvlvtettlengl
    ihlrsrdttmkemmhisklkdflikyissaknvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iklB (B:)
    ealleicqrrhflsgskqqlsrdsllsgchpgfgplgvelrknlaaewwtsvvvfreqvf
    pvdalhhkpgpllpgdsafrggrenllhgalehyvncldlvnkrlpyglaqigvcfhpvk
    sigekteaslvwftpprtsnqwldfwlrhrlqwwrkfamspsnfsssdcqdeegrkgnkl
    yynfpwgkelietlwnlgdhellhmypgnvsklhgrdgrknvvpcvlsvngdldrgmlay
    lydsfqhrkvlklhpclapikvaldvgrgptlelrqvcqglfnellengisvwpgyletm
    qssleqlyskydemsilftvlvtettlenglihlrsrdttmkemmhisklkdflikyiss
    aknv