PDB entry 3ikh

View 3ikh on RCSB PDB site
Description: Crystal structure of Ribokinase in Complex with ATP and glycerol in the active site from Klebsiella pneumoniae
Class: transferase
Keywords: TRANSFERASE,KINASE,SAD,RIBOSE,D-RIBOSE METABOLIC PROCESS,ATP,RIBOKINASE, PFKB FAMILY,11206L1,PSI-II,NYSGXRC, STRUCTURAL GENOMICS,, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, TRANSFERASE
Deposited on 2009-08-05, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbohydrate kinase
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_16990, KPN78578_16990/5340552, KPN_01729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T989 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ikha1, d3ikha2
  • Chain 'B':
    Compound: carbohydrate kinase
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_16990, KPN78578_16990/5340552, KPN_01729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T989 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ikhb1, d3ikhb2
  • Chain 'C':
    Compound: carbohydrate kinase
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_16990, KPN78578_16990/5340552, KPN_01729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T989 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ikhc1, d3ikhc2
  • Chain 'D':
    Compound: carbohydrate kinase
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_16990, KPN78578_16990/5340552, KPN_01729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T989 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ikhd1, d3ikhd2
  • Heterogens: ATP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ikhA (A:)
    mslrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrlia
    atgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsld
    emiphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidi
    avvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavm
    lasallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallttdgaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ikhA (A:)
    slrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaa
    tgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfslde
    miphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidia
    vvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavml
    asallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ikhB (B:)
    mslrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrlia
    atgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsld
    emiphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidi
    avvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavm
    lasallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallttdgaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ikhB (B:)
    lrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaat
    gndsngawirqqikneplmllpdghfnqhsdtsiilnsadnaiitttaaadtfsldemip
    hmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiavvn
    eseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmlasa
    llrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ikhC (C:)
    mslrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrlia
    atgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsld
    emiphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidi
    avvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavm
    lasallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallttdgaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ikhC (C:)
    lrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaat
    gndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsldem
    iphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiav
    vneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmla
    sallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ikhD (D:)
    mslrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrlia
    atgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsld
    emiphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidi
    avvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavm
    lasallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallttdgaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ikhD (D:)
    slrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaa
    tgndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfslde
    miphmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidia
    vvneseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavml
    asallrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt