PDB entry 3ik9

View 3ik9 on RCSB PDB site
Description: Human GST A1-1-GIMF with GSDHN
Class: transferase
Keywords: human GST A1-1 GIMF, enzyme, transferase, Cytoplasm, Polymorphism
Deposited on 2009-08-05, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3ik9a1, d3ik9a2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263 (Start-221)
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
      • engineered (221)
    Domains in SCOPe 2.07: d3ik9b1, d3ik9b2
  • Chain 'C':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3ik9c1, d3ik9c2
  • Chain 'D':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3ik9d1, d3ik9d2
  • Chain 'E':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3ik9e1, d3ik9e2
  • Chain 'F':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3ik9f1, d3ik9f2
  • Chain 'G':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3ik9g1, d3ik9g2
  • Chain 'H':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered (11)
      • engineered (106-107)
      • engineered (110)
      • engineered (207)
      • engineered (210-217)
    Domains in SCOPe 2.07: d3ik9h1, d3ik9h2
  • Heterogens: BOB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ik9A (A:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik9A (A:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ik9B (B:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik9B (B:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ik9C (C:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik9C (C:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ik9D (D:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik9D (D:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ik9E (E:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik9E (E:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ik9F (F:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik9F (F:)
    kpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkpppdeiyvrtvyni
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ik9G (G:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik9G (G:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ik9H (H:)
    maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik9H (H:)
    aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkpppdeiyvrtvynif