PDB entry 3ik3

View 3ik3 on RCSB PDB site
Description: AP24534, a Pan-BCR-ABL Inhibitor for Chronic Myeloid Leukemia, Potently Inhibits the T315I Mutant and Overcomes Mutation-Based Resistance
Class: transferase
Keywords: Bcr-Abl, CML, T315I, inhibitor, mutation, drug resistance, Alternative splicing, ATP-binding, Cell adhesion, Chromosomal rearrangement, Cytoplasm, Cytoskeleton, Kinase, Lipoprotein, Magnesium, Manganese, Metal-binding, Myristate, Nucleotide-binding, Nucleus, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase
Deposited on 2009-08-05, released 2009-11-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: Abl1, Abl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (1-285)
      • expression tag (0)
      • engineered (87)
    Domains in SCOPe 2.04: d3ik3a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: Abl1, Abl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (1-285)
      • expression tag (0)
      • engineered (87)
    Domains in SCOPe 2.04: d3ik3b_
  • Heterogens: 0LI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ik3A (A:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik3A (A:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglstytahagakfpikwtapeslay
    nkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmr
    acwqwnpsdrpsfaeihqafetmfqessisdevekelgkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ik3B (B:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik3B (B:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkr