PDB entry 3ijh

View 3ijh on RCSB PDB site
Description: Structure of S67-27 in Complex with Ko
Class: immune system
Keywords: antibody, Kdo, Chlamydia, LPS, Fab, carbohydrate, IMMUNE SYSTEM
Deposited on 2009-08-04, released 2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin light chain (IGG3)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IJH
    Domains in SCOPe 2.08: d3ijha1, d3ijha2
  • Chain 'B':
    Compound: Immunoglobulin heavy chain (IGG3)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IJH (0-225)
    Domains in SCOPe 2.08: d3ijhb_
  • Chain 'C':
    Compound: Immunoglobulin light chain (IGG3)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IJH
    Domains in SCOPe 2.08: d3ijhc1, d3ijhc2
  • Chain 'D':
    Compound: Immunoglobulin heavy chain (IGG3)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IJH (0-225)
    Domains in SCOPe 2.08: d3ijhd_
  • Heterogens: KO2, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ijhA (A:)
    divmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsnnlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ijhA (A:)
    ivmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastre
    sgvpdrftgsgsgtdftltissvqaedlavyyckqsnnlrtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ijhB (B:)
    evmlvesggglvqpgnslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardispsygvyyegfaywgqgt
    lvtvsaatttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvs
    svlqsgfyslsslvtvpsstwpsqtvicnvahpasktelikriepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ijhB (B:)
    evmlvesggglvqpgnslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardispsygvyyegfaywgqgt
    lvtvsaatttapsvyplvpggssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqs
    gfyslsslvtvpsstwpsqtvicnvahpasktelikriepr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ijhC (C:)
    divmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsnnlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ijhC (C:)
    ivmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastre
    sgvpdrftgsgsgtdftltissvqaedlavyyckqsnnlrtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ijhD (D:)
    evmlvesggglvqpgnslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardispsygvyyegfaywgqgt
    lvtvsaatttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvs
    svlqsgfyslsslvtvpsstwpsqtvicnvahpasktelikriepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ijhD (D:)
    evmlvesggglvqpgnslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardispsygvyyegfaywgqgt
    lvtvsaatttapsvyplvpggssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqs
    gfyslsslvtvpsstwpsqtvicnvahpasktelikriepr