PDB entry 3iiq

View 3iiq on RCSB PDB site
Description: Crystallographic analysis of bacterial signal peptidase in ternary complex with Arylomycin A2 and a beta-sultam inhibitor
Class: hydrolase/antibiotic/inhibitor
Keywords: ser/lys dyad, lipopeptide, serine protease, biaryl bridge, morpholino beta-sultam, antibiotic, peptidase, hydrolase-antibiotic-inhibitor complex
Deposited on 2009-08-03, released 2009-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal peptidase I
    Species: Escherichia coli [TaxId:83333]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3iiqa_
  • Chain 'B':
    Compound: Signal peptidase I
    Species: Escherichia coli [TaxId:83333]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3iiqb_
  • Chain 'C':
    Compound: arylomycin a2
    Species: Streptomyces sp. [TaxId:1931]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01115 (0-5)
    • NOR NOR00115 (0-5)
  • Chain 'D':
    Compound: arylomycin a2
    Species: Streptomyces sp. [TaxId:1931]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01115 (0-5)
    • NOR NOR00115 (0-5)
  • Heterogens: JZA, TRT, GOL, CCN, M12, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iiqA (A:)
    mvrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfk
    ypedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvq
    tfsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqp
    gqqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptgl
    rlsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iiqA (A:)
    fiyepfqipsgsmmptlligdfilvekfhpkrgdivvfkypedpkldyikravglpgdkv
    tydpvskeltiqpgcsacenalpvtysnvepsdfvqtfssgffevpknetkengirlser
    ketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdnsadsrywgf
    vpeanlvgrataiwmsfdkqegewptglrlsriggih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iiqB (B:)
    mvrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfk
    ypedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvq
    tfsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqp
    gqqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptgl
    rlsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iiqB (B:)
    iyepfqipsgsmmptlligdfilvekftghpkrgdivvfkypedpkldyikravglpgdk
    vtydpvskeltiqpgcssgcenalpvtysnvepsdfvqtfsrrnatsgffevpknetken
    girlserketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdnsa
    dsrywgfvpeanlvgrataiwmsfdkqegewptglrlsriggih
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.