PDB entry 3ii5

View 3ii5 on RCSB PDB site
Description: The Complex of wild-type B-RAF with Pyrazolo pyrimidine inhibitor
Class: transferase
Keywords: B-Raf, Kinase, protein-inhibitor complex, Acetylation, ATP-binding, Cardiomyopathy, Cytoplasm, Disease mutation, Metal-binding, Nucleotide-binding, Phorbol-ester binding, Phosphoprotein, Polymorphism, Proto-oncogene, Serine/threonine-protein kinase, Transferase, Zinc, Zinc-finger
Deposited on 2009-07-31, released 2009-11-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.209
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ii5a_
  • Chain 'B':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ii5b_
  • Heterogens: 831, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ii5A (A:)
    mdrgshhhhhhsedrnrmktlgrrdssddweipdgqitvgqrigsgsfgtvykgkwhgdv
    avkmlnvtaptpqqlqafknevgvlrktrhvnillfmgystkpqlaivtqwcegsslyhh
    lhiietkfemiklidiarqtaqgmdylhaksiihrdlksnniflhedltvkigdfglatv
    ksrwsgshqfeqlsgsilwmapevirmqdknpysfqsdvyafgivlyelmtgqlpysnin
    nrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfpqilasiellars
    lpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ii5A (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvqlsgsilwmapevirmqdknpysfqsd
    vyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclk
    kkrderplfpqilasiellars
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ii5B (B:)
    mdrgshhhhhhsedrnrmktlgrrdssddweipdgqitvgqrigsgsfgtvykgkwhgdv
    avkmlnvtaptpqqlqafknevgvlrktrhvnillfmgystkpqlaivtqwcegsslyhh
    lhiietkfemiklidiarqtaqgmdylhaksiihrdlksnniflhedltvkigdfglatv
    ksrwsgshqfeqlsgsilwmapevirmqdknpysfqsdvyafgivlyelmtgqlpysnin
    nrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfpqilasiellars
    lpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ii5B (B:)
    dweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrkt
    rhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdylh
    aksiihrdlksnniflhedltvkigdfglagsilwmapevirmqdknpysfqsdvyafgi
    vlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrder
    plfpqilasiellarsl