PDB entry 3ihs

View 3ihs on RCSB PDB site
Description: Crystal Structure of a Phosphocarrier Protein HPr from Bacillus anthracis str. Ames
Class: transport protein
Keywords: phosphocarrier protein HPr, dimerization domain swap beta strand, IDP01131, STRUCTURAL GENOMICS, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES, CSGID, TRANSPORT PROTEIN
Deposited on 2009-07-30, released 2009-08-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.157
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphocarrier protein HPr
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Gene: BAS5001, BA_5381, GBAA5381, GBAA_5381, ptsH-2, ptsH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81X62 (24-105)
      • expression tag (21-23)
    Domains in SCOPe 2.03: d3ihsa_
  • Chain 'B':
    Compound: Phosphocarrier protein HPr
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Gene: BAS5001, BA_5381, GBAA5381, GBAA_5381, ptsH-2, ptsH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81X62 (24-105)
      • expression tag (22-23)
    Domains in SCOPe 2.03: d3ihsb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ihsA (A:)
    mhhhhhhssgvdlgtenlyfqsnamvqkrvqvslknglqarpaalfvqeanrfhadifie
    kdgktvnaksimgimslaigtgsmitittegsdaeealealaayvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ihsA (A:)
    snamvqkrvqvslknglqarpaalfvqeanrfhadifiekdgktvnaksimgimslaigt
    gsmitittegsdaeealealaayvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ihsB (B:)
    mhhhhhhssgvdlgtenlyfqsnamvqkrvqvslknglqarpaalfvqeanrfhadifie
    kdgktvnaksimgimslaigtgsmitittegsdaeealealaayvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ihsB (B:)
    namvqkrvqvslknglqarpaalfvqeanrfhadifiekdgktvnaksimgimslaigtg
    smitittegsdaeealealaayvq