PDB entry 3ihc

View 3ihc on RCSB PDB site
Description: Crystal structure of mouse Bcl-xl (wt) at pH 5.0
Class: apoptosis
Keywords: Apoptosis, BH3 domain, BCL-2, Membrane, Mitochondrion, Transmembrane
Deposited on 2009-07-30, released 2010-04-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.206
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bcl-2-like protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Bcl-xl, Bcl2l, Bcl2l1, Bclx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ihca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ihcA (A:)
    msqsnrelvvdflsyklsqkgyswsqfsdveenrteapeeteaeretpsaingnpswhla
    dspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
    qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaswmatylndhlep
    wiqenggwdtfvdlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ihcA (A:)
    sqsnrelvvdflsyklsqkgyswsqfpmaavkqalreagdefelryrrafsdltsqlhit
    pgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaswmatyln
    dhlepwiqenggwdtfvdlyg