PDB entry 3ih4

View 3ih4 on RCSB PDB site
Description: TM1030 crystallized at 277K
Class: transcription regulator
Keywords: transcriptional regulator, TM1030, temperature, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, DNA-binding, Transcription, Transcription regulation, transcription regulator
Deposited on 2009-07-29, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1030, TM_1030
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0C0 (2-201)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3ih4a1, d3ih4a2, d3ih4a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ih4A (A:)
    ghmlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsv
    teklqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkril
    ldleksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkr
    dmntlveevkvmlrilkkgmtk