PDB entry 3igj

View 3igj on RCSB PDB site
Description: Crystal Structure of Maltose O-acetyltransferase Complexed with Acetyl Coenzyme A from Bacillus anthracis
Class: transferase
Keywords: BETA HELIX, Acetyl Co-A complex, Acyltransferase, Transferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2009-07-27, released 2009-08-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.175
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose o-acetyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3155, BA_3402, GBAA3402, GBAA_3402, maA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3igja_
  • Chain 'B':
    Compound: maltose o-acetyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3155, BA_3402, GBAA3402, GBAA_3402, maA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3igjb_
  • Chain 'C':
    Compound: maltose o-acetyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3155, BA_3402, GBAA3402, GBAA_3402, maA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81N16 (3-189)
      • expression tag (2)
    Domains in SCOPe 2.06: d3igjc1, d3igjc2
  • Heterogens: ACO, SO4, GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3igjA (A:)
    snamktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgss
    adgkaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathpl
    hpvernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggn
    pakviktiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3igjA (A:)
    ktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssadgk
    aqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhpve
    rnsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpakv
    iktiee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3igjB (B:)
    snamktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgss
    adgkaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathpl
    hpvernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggn
    pakviktiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3igjB (B:)
    mktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssadg
    kaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhpv
    ernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpak
    viktiee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3igjC (C:)
    snamktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgss
    adgkaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathpl
    hpvernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggn
    pakviktiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3igjC (C:)
    amktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssad
    gkaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhp
    vernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpa
    kviktiee