PDB entry 3ieu

View 3ieu on RCSB PDB site
Description: Crystal Structure of ERA in Complex with GDP
Class: Nucleotide binding protein
Keywords: ERA, GTPase, KH domain, GDP, Cell membrane, GTP-binding, Membrane, Nucleotide-binding, Phosphoprotein, RNA-binding, Nucleotide binding protein
Deposited on 2009-07-23, released 2009-08-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.208
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein era
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b2566, era, Escherichia coli, JW2550, rbaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ieua1, d3ieua2
  • Chain 'B':
    Compound: GTP-binding protein era
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b2566, era, Escherichia coli, JW2550, rbaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ieub1, d3ieub2
  • Heterogens: GDP, SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ieuA (A:)
    msidksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiy
    vdtpglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvi
    lavnkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhf
    pedyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilvere
    gqkkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslgyvdd
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ieuA (A:)
    dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
    pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
    nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfped
    yitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregqk
    kmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ieuB (B:)
    msidksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiy
    vdtpglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvi
    lavnkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhf
    pedyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilvere
    gqkkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslgyvdd
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ieuB (B:)
    dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
    pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
    nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfped
    yitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregqk
    kmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg