PDB entry 3iet

View 3iet on RCSB PDB site
Description: Crystal Structure of 237mAb with antigen
Class: immune system
Keywords: glycopepitde, antibody, Fab, carbohydrate-biding, tumour, IMMUNE SYSTEM
Deposited on 2009-07-23, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.229
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin light chain (IgG2a)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3IET
    Domains in SCOPe 2.07: d3ieta1, d3ieta2
  • Chain 'B':
    Compound: Immunoglobulin heavy chain (IgG2a)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3IET (0-End)
  • Chain 'C':
    Compound: Immunoglobulin light chain (IgG2a)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3IET (0-216)
    Domains in SCOPe 2.07: d3ietc1, d3ietc2
  • Chain 'D':
    Compound: Immunoglobulin heavy chain (IgG2a)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3IET (0-217)
  • Chain 'Q':
    Compound: Podoplanin
    Species: Mus musculus [TaxId:10090]
    Gene: Pdpn, RP23-348F1.2-002
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Podoplanin
    Species: Mus musculus [TaxId:10090]
    Gene: Pdpn, RP23-348F1.2-002
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, A2G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ietA (A:)
    diqltqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkissveaedlgvyfcsqsthvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ietA (A:)
    iqltqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrfs
    gvpdrfsgsgsgtdftlkissveaedlgvyfcsqsthvptfgggtkleikradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnre
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ietC (C:)
    diqltqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkissveaedlgvyfcsqsthvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrec
    

  • Chain 'D':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'X':
    No sequence available.