PDB entry 3iea

View 3iea on RCSB PDB site
Description: Structure of reduced M98L mutant of amicyanin
Class: electron transport
Keywords: TYPE-I BLUE COPPER PROTEIN; BETA SANDWICH, ELECTRON TRANSPORT, Copper, Metal-binding, Periplasm, Transport
Deposited on 2009-07-22, released 2009-10-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: ami, mauC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered (97)
    Domains in SCOPe 2.04: d3ieaa_
  • Heterogens: PO4, CU, ZN, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ieaA (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpflrgkvvve