PDB entry 3idx

View 3idx on RCSB PDB site
Description: Crystal structure of HIV-gp120 core in complex with CD4-binding site antibody b13, space group C222
Class: immune system
Keywords: HIV-1, antibody, gp120, b13, Envelope glycan protein, CD4-binding site, AIDS, Apoptosis, Cell membrane, Cleavage on pair of basic residues, Disulfide bond, Envelope protein, Fusion protein, Host-virus interaction, Membrane, Transmembrane, Viral immunoevasion, Virion, IMMUNE SYSTEM
Deposited on 2009-07-22, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: HIV-1 HxBc2 gp120 core
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • PDB 3IDX (0-316)
    Domains in SCOPe 2.06: d3idxg_
  • Chain 'H':
    Compound: Fab b13 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IDX (0-230)
  • Chain 'L':
    Compound: Fab b13 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IDX (0-End)
    Domains in SCOPe 2.06: d3idxl1, d3idxl2
  • Heterogens: NAG, EPE, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3idxG (G:)
    evvlvnvtenfnwckndmveqmhedicslwdqslkpcvkltplcvgagscntsvitqacp
    kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
    eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
    nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstwstegsnntegsdtit
    lpcrikqiinmwckvgkmmyappisgqircssnitgllltrdggnsnneseifrpgggdm
    rdnwrselykykvvkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3idxG (G:)
    evvlvnvtenfnwckndmveqmhedicslwdqslkpcvkltplcvgagscntsvitqacp
    kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
    eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
    nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnsgsdtitlpcrikqiinm
    wckvgkmmyappisgqircssnitgllltrdggnsnneseifrpgggdmrdnwrselyky
    kvvkie
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3idxL (L:)
    diqmtqspsslsasvgdrvtitcqasqdirnylnwyqqkpgkapklliydasnsetgvps
    rfsgsgsgrdftftisslqpedvatyycqqhqnvplttfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3idxL (L:)
    diqmtqspsslsasvgdrvtitcqasqdirnylnwyqqkpgkapklliydasnsetgvps
    rfsgsgsgrdftftisslqpedvatyycqqhqnvplttfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrge