PDB entry 3ids

View 3ids on RCSB PDB site
Description: Structure of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi in complex with the irreversible iodoacetamide inhibitor
Class: oxidoreductase
Keywords: IRREVERSIBLE INHIBITOR, PROTEIN-LIGAND COMPLEX,X-RAY, GLYCOLYSIS, NAD, OXIREDUCTASE, Glycosome, Oxidoreductase
Deposited on 2009-07-21, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3idsa1, d3idsa2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3idsb1, d3idsb2
  • Chain 'C':
    Compound: glyceraldehyde-3-phosphate dehydrogenase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3idsc1, d3idsc2
  • Chain 'D':
    Compound: glyceraldehyde-3-phosphate dehydrogenase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3idsd1, d3idsd2
  • Heterogens: ACM, GOL, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3idsA (A:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3idsB (B:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3idsC (C:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3idsD (D:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl