PDB entry 3idp

View 3idp on RCSB PDB site
Description: B-Raf V600E kinase domain in complex with an aminoisoquinoline inhibitor
Class: transferase
Keywords: oncogene, ATP-binding, DFG-out, transferase, Cardiomyopathy, Disease mutation, Kinase, Metal-binding, Nucleotide-binding, Phorbol-ester binding, Phosphoprotein, Proto-oncogene, Serine/threonine-protein kinase, Zinc-finger
Deposited on 2009-07-21, released 2009-10-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3idpa_
  • Chain 'B':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3idpb_
  • Heterogens: L1E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3idpA (A:)
    hhhhhhdrnrmktlgrrdssddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnv
    taptpqqlqafknevgvlrktrhvnillfmgystkpqlaivtqwcegsslyhhlhiietk
    femiklidiarqtaqgmdylhaksiihrdlksnniflhedltvkigdfglateksrwsgs
    hqfeqlsgsilwmapevirmqdknpysfqsdvyafgivlyelmtgqlpysninnrdqiif
    mvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfpqilasiellarslpkihrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3idpA (A:)
    dweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrkt
    rhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdylh
    aksiihrdlksnniflhedltvkigdfglatgsilwmapevirmqnpysfqsdvyafgiv
    lyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrderp
    lfpqilasiellars
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3idpB (B:)
    hhhhhhdrnrmktlgrrdssddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnv
    taptpqqlqafknevgvlrktrhvnillfmgystkpqlaivtqwcegsslyhhlhiietk
    femiklidiarqtaqgmdylhaksiihrdlksnniflhedltvkigdfglateksrwsgs
    hqfeqlsgsilwmapevirmqdknpysfqsdvyafgivlyelmtgqlpysninnrdqiif
    mvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfpqilasiellarslpkihrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3idpB (B:)
    dweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrkt
    rhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdylh
    aksiihrdlksnniflhedltvkigdfglsgsilwmapevirmqdknpysfqsdvyafgi
    vlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrder
    plfpqilasiellars