PDB entry 3icb

View 3icb on RCSB PDB site
Description: the refined structure of vitamin d-dependent calcium-binding protein from bovine intestine. molecular details, ion binding, and implications for the structure of other calcium-binding proteins
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1986-09-09, released 1986-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.178
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calcium-binding protein
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02633 (0-74)
  Domains in SCOPe 2.06: d3icba_
• Heterogens: CA, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3icbA (A:)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdge
  vsfeefqvlvkkisq