PDB entry 3ib4

View 3ib4 on RCSB PDB site
Description: The double mutant of Beta-2 microglobulin K58P-W60G
Class: immune system
Keywords: amyloidosis, Beta-sandwich, Glycine, Proline, mutation, dialysis related amyloidosis, DE loop, Disease mutation, Disulfide bond, Glycation, Glycoprotein, Immune response, Immunoglobulin domain, MHC I, Pyrrolidone carboxylic acid, Secreted, IMMUNE SYSTEM
Deposited on 2009-07-15, released 2010-07-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.159
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: NM_004048
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • initiating methionine (0)
      • engineered mutation (58)
      • engineered mutation (60)
    Domains in SCOPe 2.02: d3ib4a_
  • Heterogens: PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ib4A (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfspd
    gsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm