PDB entry 3ias

View 3ias on RCSB PDB site
Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution
Class: oxidoreductase
Keywords: oxidoreductase, electron transport, respiratory chain
Deposited on 2009-07-14, released 2009-09-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.238
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: NADH-quinone oxidoreductase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ias11, d3ias12, d3ias13
  • Chain '2':
    Compound: NADH-quinone oxidoreductase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ias2_
  • Chain '3':
    Compound: NADH-quinone oxidoreductase subunit 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ias31, d3ias32, d3ias33, d3ias34
  • Chain '4':
    Compound: NADH-quinone oxidoreductase subunit 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ias4_
  • Chain '5':
    Compound: NADH-quinone oxidoreductase subunit 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ias5_
  • Chain '6':
    Compound: NADH-quinone oxidoreductase subunit 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ias6_
  • Chain '7':
    Compound: NADH-quinone oxidoreductase subunit 15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ias7_
  • Chain '9':
    Compound: NADH-quinone oxidoreductase subunit 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ias9_
  • Chain 'A':
    Compound: NADH-quinone oxidoreductase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasa1, d3iasa2, d3iasa3
  • Chain 'B':
    Compound: NADH-quinone oxidoreductase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasb_
  • Chain 'C':
    Compound: NADH-quinone oxidoreductase subunit 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasc1, d3iasc2, d3iasc3, d3iasc4
  • Chain 'D':
    Compound: NADH-quinone oxidoreductase subunit 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasd_
  • Chain 'E':
    Compound: NADH-quinone oxidoreductase subunit 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iase_
  • Chain 'F':
    Compound: NADH-quinone oxidoreductase subunit 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasf_
  • Chain 'G':
    Compound: NADH-quinone oxidoreductase subunit 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasg_
  • Chain 'H':
    Compound: NADH-quinone oxidoreductase subunit 15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iash_
  • Chain 'J':
    Compound: NADH-quinone oxidoreductase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasj1, d3iasj2, d3iasj3
  • Chain 'K':
    Compound: NADH-quinone oxidoreductase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iask_
  • Chain 'L':
    Compound: NADH-quinone oxidoreductase subunit 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasl1, d3iasl2, d3iasl3, d3iasl4
  • Chain 'M':
    Compound: NADH-quinone oxidoreductase subunit 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasm_
  • Chain 'N':
    Compound: NADH-quinone oxidoreductase subunit 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasn_
  • Chain 'O':
    Compound: NADH-quinone oxidoreductase subunit 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iaso_
  • Chain 'P':
    Compound: NADH-quinone oxidoreductase subunit 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasp_
  • Chain 'Q':
    Compound: NADH-quinone oxidoreductase subunit 15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasq_
  • Chain 'S':
    Compound: NADH-quinone oxidoreductase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iass1, d3iass2, d3iass3
  • Chain 'T':
    Compound: NADH-quinone oxidoreductase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iast_
  • Chain 'U':
    Compound: NADH-quinone oxidoreductase subunit 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasu1, d3iasu2, d3iasu3, d3iasu4
  • Chain 'V':
    Compound: NADH-quinone oxidoreductase subunit 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasv_
  • Chain 'W':
    Compound: NADH-quinone oxidoreductase subunit 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasw_
  • Chain 'X':
    Compound: NADH-quinone oxidoreductase subunit 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasx_
  • Chain 'Y':
    Compound: NADH-quinone oxidoreductase subunit 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasy_
  • Chain 'Z':
    Compound: NADH-quinone oxidoreductase subunit 15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3iasz_
  • Heterogens: SF4, FES, FMN, CA

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3ias1 (1:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ias1 (1:)
    tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
    lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
    gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
    cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
    gteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplp
    fteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcre
    gvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqy
    lalarekrpvprpslwr
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3ias2 (2:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ias2 (2:)
    ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
    vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
    eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >3ias3 (3:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ias3 (3:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
    klaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtvey
    glyekyelpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfi
    ergvhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgc
    gitadtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatwe
    eaflalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfp
    pasledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermpr
    rtdkmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknp
    vlilgagvlqdtvaaerarllaerkgakvlamtpaanargleamgvlpgakgaswdepga
    lyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlp
    lspapiengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkel
    rpkerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrv
    earvvhredvpkghlylsalgpaaglrvegrvlv
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >3ias4 (4:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ias4 (4:)
    mtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfa
    hdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafre
    retildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaesp
    ifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdv
    fdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyt
    egfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpd
    mvaiiasldpvmgdvdr
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >3ias5 (5:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ias5 (5:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslw
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >3ias6 (6:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ias6 (6:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdarqadvmivagrlskkmap
    vmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiya
    vmqlqkkvrgqaynergerlppvaa
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >3ias7 (7:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ias7 (7:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >3ias9 (9:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ias9 (9:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iasA (A:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasA (A:)
    tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
    lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
    gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
    cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
    gteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplp
    fteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcre
    gvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqy
    lalarekrpvprpslwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iasB (B:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasB (B:)
    ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
    vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
    eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3iasC (C:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasC (C:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
    klaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtvey
    glyekyelpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfi
    ergvhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgc
    gitadtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatwe
    eaflalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfp
    pasledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermpr
    rtdkmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknp
    vlilgagvlqdtvaaerarllaerkgakvlamtpaanargleamgvlpgakgaswdepga
    lyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlp
    lspapiengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkel
    rpkerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrv
    earvvhredvpkghlylsalgpaaglrvegrvlv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3iasD (D:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasD (D:)
    mtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfa
    hdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafre
    retildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaesp
    ifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdv
    fdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyt
    egfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpd
    mvaiiasldpvmgdvdr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3iasE (E:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasE (E:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3iasF (F:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasF (F:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdarqadvmivagrlskkmap
    vmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiya
    vmqlqkkvrgqaynergerlppvaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3iasG (G:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasG (G:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3iasH (H:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasH (H:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3iasJ (J:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasJ (J:)
    tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
    lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
    gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
    cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
    gteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplp
    fteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcre
    gvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqy
    lalarekrpvprpslwr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3iasK (K:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasK (K:)
    ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
    vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
    eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3iasL (L:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasL (L:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
    klaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtvey
    glyekyelpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfi
    ergvhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgc
    gitadtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatwe
    eaflalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfp
    pasledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermpr
    rtdkmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknp
    vlilgagvlqdtvaaerarllaerkgakvlamtpaanargleamgvlpgakgaswdepga
    lyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlp
    lspapiengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkel
    rpkerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrv
    earvvhredvpkghlylsalgpaaglrvegrvlv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3iasM (M:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasM (M:)
    mtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfa
    hdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafre
    retildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaesp
    ifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdv
    fdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyt
    egfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpd
    mvaiiasldpvmgdvdr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3iasN (N:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasN (N:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3iasO (O:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasO (O:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdarqadvmivagrlskkmap
    vmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiya
    vmqlqkkvrgqaynergerlppvaa
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3iasP (P:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasP (P:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3iasQ (Q:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasQ (Q:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3iasS (S:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasS (S:)
    tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
    lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
    gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
    cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
    gteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplp
    fteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcre
    gvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqy
    lalarekrpvprpslwr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3iasT (T:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasT (T:)
    ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
    vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
    eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3iasU (U:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasU (U:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
    klaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtvey
    glyekyelpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfi
    ergvhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgc
    gitadtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatwe
    eaflalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfp
    pasledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermpr
    rtdkmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknp
    vlilgagvlqdtvaaerarllaerkgakvlamtpaanargleamgvlpgakgaswdepga
    lyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlp
    lspapiengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkel
    rpkerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrv
    earvvhredvpkghlylsalgpaaglrvegrvlv
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3iasV (V:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasV (V:)
    mtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfa
    hdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafre
    retildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaesp
    ifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdv
    fdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyt
    egfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpd
    mvaiiasldpvmgdvdr
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3iasW (W:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasW (W:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslw
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3iasX (X:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasX (X:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdarqadvmivagrlskkmap
    vmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiya
    vmqlqkkvrgqaynergerlppvaa
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3iasY (Y:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasY (Y:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3iasZ (Z:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iasZ (Z:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa