PDB entry 3iak

View 3iak on RCSB PDB site
Description: Crystal structure of human phosphodiesterase 4d (PDE4d) with papaverine.
Class: hydrolase
Keywords: cAMP-specific, Alternative splicing, cAMP, Cytoplasm, Cytoskeleton, Hydrolase, Membrane, Metal-binding, Phosphoprotein
Deposited on 2009-07-14, released 2009-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.241
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08499 (21-End)
      • expression tag (20)
    Domains in SCOPe 2.07: d3iaka1, d3iaka2
  • Heterogens: ZN, MG, EV1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iakA (A:)
    mgsshhhhhhssglvprgshmteqedvlakeledvnkwglhvfriaelsgnrpltvimht
    ifqerdllktfkipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleav
    ftdleilaaifasaihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqee
    ncdifqnltkkqrqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnys
    driqvlqnmvhcadlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnas
    veksqvgfidyivhplwetwadlvhpdaqdildtlednrewyqstipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iakA (A:)
    mteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlit
    ylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdh
    pgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmv
    idivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptk
    plqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetw
    adlvhpdaqdildtlednrewyqst