PDB entry 3iaj

View 3iaj on RCSB PDB site
Description: Crystal structure of a betagamma-crystallin domain from Clostridium beijerinckii-in alternate space group I422
Class: metal binding protein
Keywords: calcium-bound betagamma-crystallin, METAL BINDING PROTEIN
Deposited on 2009-07-14, released 2009-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta and gamma crystallin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: 5294019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3iaja_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3iajA (A:)
kavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftgt
kwtytsdtpwvgndandkmtsvkiyst