PDB entry 3iad

View 3iad on RCSB PDB site
Description: Crystal structure of human phosphodiesterase 4D with bound allosteric modulator
Class: hydrolase
Keywords: PDE4D, Allosteric modulatory, inhibitor, UCR2, Alternative splicing, cAMP, Cytoplasm, Cytoskeleton, Hydrolase, Membrane, Metal-binding, Phosphoprotein
Deposited on 2009-07-13, released 2010-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iada_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iadb_
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iadc_
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iadd_
  • Heterogens: 15X, ZN, MG, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iadA (A:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisn
    tfldenlyfqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iadA (A:)
    gvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtl
    itylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdv
    dhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrk
    mvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnp
    tkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwe
    twadlvhpdaqdildtlednrewyqstnqvsefisntfld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iadB (B:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisn
    tfldenlyfqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iadB (B:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
    vhpdaqdildtlednrewyqstipqnqvsefisntfld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3iadC (C:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisn
    tfldenlyfqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iadC (C:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstignqvsefisntfld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3iadD (D:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisn
    tfldenlyfqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iadD (D:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
    vhpdaqdildtlednrewyqstipqgnqvsefisntfld