PDB entry 3ia6

View 3ia6 on RCSB PDB site
Description: X-ray Crystal structure of the nuclear hormone receptor PPAR-gamma in a complex with a PPAR gamma/alpha dual agonist
Class: Transcription
Keywords: Protein-ligand complex, dual specificity, inhibitor, Activator, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger
Deposited on 2009-07-13, released 2009-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.241
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ia6a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ia6b_
  • Heterogens: UNT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ia6A (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ia6A (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkevair
    ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl
    isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl
    lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkte
    tdmslhpllqeiyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ia6B (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ia6B (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkk
    evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
    kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
    drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
    ikktethpllqeiyk