PDB entry 3i9z

View 3i9z on RCSB PDB site
Description: Crystal structure of a metallochaperone with a trinuclear Cu(I) cluster
Class: chaperone
Keywords: CHAPERONE, Copper, Cytoplasm, Metal-binding
Deposited on 2009-07-13, released 2009-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper chaperone copZ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU33510, copZ, COPZ_BACSU, yvgY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i9za_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3i9zA (A:)
meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai
edqgydvak