PDB entry 3i9q

View 3i9q on RCSB PDB site
Description: Crystal Structure of the triple mutant S19G-P20D-R21S of alpha spectrin SH3 domain
Class: structural protein
Keywords: SH3-like barrel, Actin capping, Actin-binding, Calmodulin-binding, Cytoskeleton, Phosphoprotein, SH3 domain, STRUCTURAL PROTEIN
Deposited on 2009-07-12, released 2009-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.232
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spectrin alpha chain
    Species: Gallus gallus [TaxId:9031]
    Gene: SPTAN1, SPTA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (0-56)
      • engineered (13-15)
    Domains in SCOPe 2.06: d3i9qa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3i9qA (A:)
kelvlalydyqekgdsevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld