PDB entry 3i9p

View 3i9p on RCSB PDB site
Description: Crystal structure of human transthyretin - wild type
Class: transport protein
Keywords: Human transthyretin, TRANSPORT PROTEIN, Amyloid, Amyloidosis, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Hormone, Neuropathy, Polymorphism, Retinol-binding, Secreted, Thyroid hormone, Transport, Vitamin A
Deposited on 2009-07-12, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_25470, PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3i9pa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_25470, PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3i9pb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3i9pA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3i9pB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

    Sequence, based on observed residues (ATOM records): (download) 
    >3i9pB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn