PDB entry 3i9i

View 3i9i on RCSB PDB site
Description: Crystal structure of human transthyretin variant A25T - #2
Class: hormone-binding protein
Keywords: human transthyretin, A25T, Amyloid, Amyloidosis, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Hormone, Neuropathy, Retinol-binding, Secreted, Thyroid hormone, Transport, Vitamin A, hormone-binding protein
Deposited on 2009-07-11, released 2011-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-115)
      • engineered (15)
    Domains in SCOPe 2.08: d3i9ia_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-End)
      • engineered (15)
    Domains in SCOPe 2.08: d3i9ib_
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i9iA (A:)
    cplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i9iB (B:)
    cplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9iB (B:)
    cplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn