PDB entry 3i9h

View 3i9h on RCSB PDB site
Description: Crystal structure of a betagamma-crystallin domain from Clostridium beijerinckii
Class: metal binding protein
Keywords: calcium-bound betagamma-crystallin, METAL BINDING PROTEIN
Deposited on 2009-07-11, released 2009-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta and gamma crystallin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: 5294019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9ha_
  • Chain 'B':
    Compound: Beta and gamma crystallin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: 5294019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9hb_
  • Chain 'C':
    Compound: Beta and gamma crystallin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: 5294019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9hc_
  • Chain 'D':
    Compound: Beta and gamma crystallin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: 5294019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9hd_
  • Chain 'E':
    Compound: Beta and gamma crystallin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: 5294019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9he_
  • Chain 'F':
    Compound: Beta and gamma crystallin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: 5294019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9hf_
  • Chain 'G':
    Compound: Beta and gamma crystallin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: 5294019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9hg_
  • Chain 'H':
    Compound: Beta and gamma crystallin
    Species: Clostridium beijerinckii [TaxId:290402]
    Gene: 5294019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9hh_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i9hA (A:)
    tkavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftg
    tkwtytsdtpwvgndandkmtsvkiyst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9hA (A:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmtsvkiyst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i9hB (B:)
    tkavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftg
    tkwtytsdtpwvgndandkmtsvkiyst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9hB (B:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmtsvkiyst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i9hC (C:)
    tkavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftg
    tkwtytsdtpwvgndandkmtsvkiyst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9hC (C:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmtsvkiyst
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i9hD (D:)
    tkavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftg
    tkwtytsdtpwvgndandkmtsvkiyst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9hD (D:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmtsvkiyst
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i9hE (E:)
    tkavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftg
    tkwtytsdtpwvgndandkmtsvkiyst
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3i9hF (F:)
    tkavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftg
    tkwtytsdtpwvgndandkmtsvkiyst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9hF (F:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmtsvkiyst
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3i9hG (G:)
    tkavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftg
    tkwtytsdtpwvgndandkmtsvkiyst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9hG (G:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmtsvkiyst
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3i9hH (H:)
    tkavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftg
    tkwtytsdtpwvgndandkmtsvkiyst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9hH (H:)
    kavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftgt
    kwtytsdtpwvgndandkmtsvkiyst