PDB entry 3i9a

View 3i9a on RCSB PDB site
Description: Crystal structure of human transthyretin variant A25T - #1
Class: hormone
Keywords: human transthyretin, A25T, amyloidosis, Amyloid, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Hormone, Neuropathy, Retinol-binding, Secreted, Thyroid hormone, Transport, Vitamin A
Deposited on 2009-07-10, released 2010-08-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.204
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (24)
    Domains in SCOPe 2.03: d3i9aa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (24)
    Domains in SCOPe 2.03: d3i9ab_
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i9aA (A:)
    gptgtgeskcplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9aA (A:)
    cplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i9aB (B:)
    gptgtgeskcplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9aB (B:)
    cplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn