PDB entry 3i91

View 3i91 on RCSB PDB site
Description: Crystal structure of human chromobox homolog 8 (CBX8) with H3K9 peptide
Class: transcription
Keywords: Chromobox homolog 8, CBX8, H3K9 peptide, Structural Genomics, Structural Genomics Consortium, SGC, Chromatin regulator, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation
Deposited on 2009-07-10, released 2009-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 8
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX8, PC3, RC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i91a_
  • Chain 'B':
    Compound: Chromobox protein homolog 8
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX8, PC3, RC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i91b_
  • Chain 'C':
    Compound: H3K9 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3I91 (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3i91A (A:)
ervfaaeallkrrirkgrmeylvkwkgwsqkystwepeenildarllaafeere

    Sequence, based on observed residues (ATOM records): (download) 
    >3i91A (A:)
rvfaaeallkrrirkgrmeylvkwkgwsqkystwepeenildarllaafeer

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3i91B (B:)
ervfaaeallkrrirkgrmeylvkwkgwsqkystwepeenildarllaafeere

    Sequence, based on observed residues (ATOM records): (download) 
    >3i91B (B:)
rvfaaeallkrrirkgrmeylvkwkgwsqkystwepeenildarllaafeer

  • Chain 'C':
    No sequence available.