PDB entry 3i90
View 3i90 on RCSB PDB site
Description: Crystal structure of human chromobox homolog 6 (CBX6) with H3K27 peptide
Class: transcription
Keywords: chromobox homolog 6, CBX6, H3K27 peptide, Structural Genomics, Structural Genomics Consortium, SGC, Chromatin regulator, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation
Deposited on
2009-07-10, released
2009-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.254
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Chromobox protein homolog 6
Species: Homo sapiens [TaxId:9606]
Gene: CBX6
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3i90a_ - Chain 'B':
Compound: Chromobox protein homolog 6
Species: Homo sapiens [TaxId:9606]
Gene: CBX6
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3i90b_ - Chain 'C':
Compound: H3K27 peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: H3K27 peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3i90A (A:)
rvfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafeq
Sequence, based on observed residues (ATOM records): (download)
>3i90A (A:)
rvfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafe
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3i90B (B:)
rvfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafeq
Sequence, based on observed residues (ATOM records): (download)
>3i90B (B:)
vfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafeq
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.