PDB entry 3i90

View 3i90 on RCSB PDB site
Description: Crystal structure of human chromobox homolog 6 (CBX6) with H3K27 peptide
Class: transcription
Keywords: chromobox homolog 6, CBX6, H3K27 peptide, Structural Genomics, Structural Genomics Consortium, SGC, Chromatin regulator, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation
Deposited on 2009-07-10, released 2009-09-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.254
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3i90a_
  • Chain 'B':
    Compound: Chromobox protein homolog 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3i90b_
  • Chain 'C':
    Compound: H3K27 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3I90 (0-10)
  • Chain 'D':
    Compound: H3K27 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3I90 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i90A (A:)
    rvfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i90A (A:)
    rvfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i90B (B:)
    rvfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i90B (B:)
    vfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafeq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.