PDB entry 3i8w

View 3i8w on RCSB PDB site
Description: Crystal structure of a metallacarborane inhibitor bound to HIV protease
Class: hydrolase/hydrolase inhibitor
Keywords: inhibitor, cobalt bis(1,2-dicarbollide), viral resistance, aspartic protease, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, Cell membrane, DNA integration, DNA recombination, DNA-directed DNA polymerase, Endonuclease, Hydrolase, Lipoprotein, Magnesium, Membrane, Metal-binding, Multifunctional enzyme, Myristate, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Protease, RNA-binding, RNA-directed DNA polymerase, Transferase, Viral nucleoprotein, Virion, Zinc-finger, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2009-07-10, released 2009-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
    Domains in SCOPe 2.08: d3i8wa_
  • Heterogens: CB5, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i8wA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf