PDB entry 3i8t

View 3i8t on RCSB PDB site
Description: N-terminal CRD1 domain of mouse Galectin-4 in complex with lactose
Class: sugar binding protein
Keywords: S-Type Lectin, Carbohydrate binding, molecular recognition, Lectin, SUGAR BINDING PROTEIN
Deposited on 2009-07-10, released 2011-02-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-4
    Species: Mus musculus [TaxId:10090]
    Gene: gal-4, Lgals4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3i8ta_
  • Heterogens: LBT, GOL, PEG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3i8tA (A:)
mrgshhhhhhtdpayvpapgyqptynptlpykrpipgglsvgmsvyiqgmakenmrrfhv
nfavgqddgadvafhfnprfdgwdkvvfntmqsgqwgkeekkksmpfqkgkhfelvfmvm
pehykvvvngnsfyeyghrlpvqmvthlqvdgdlelqsinflgg

    Sequence, based on observed residues (ATOM records): (download) 
    >3i8tA (A:)
ynptlpykrpipgglsvgmsvyiqgmakenmrrfhvnfavgqddgadvafhfnprfdgwd
kvvfntmqsgqwgkeekkksmpfqkgkhfelvfmvmpehykvvvngnsfyeyghrlpvqm
vthlqvdgdlelqsinflgg