PDB entry 3i8r

View 3i8r on RCSB PDB site
Description: Crystal structure of the heme oxygenase from Corynebacterium diphtheriae (HmuO) in complex with heme binding ditiothreitol (DTT)
Class: Oxidoreductase
Keywords: Inhibitor, heme oxygenase, DTT, Oxidoreductase
Deposited on 2009-07-10, released 2010-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.197
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i8ra_
  • Chain 'B':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i8rb_
  • Chain 'C':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i8rc_
  • Heterogens: HEM, SO4, DTV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i8rA (A:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i8rA (A:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i8rB (B:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i8rB (B:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlgkgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i8rC (C:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i8rC (C:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlgk