PDB entry 3i7x

View 3i7x on RCSB PDB site
Description: High pressure structure of I106A RNase A variant (0.35 GPa)
Class: Hydrolase
Keywords: bovine pancreatic ribonuclease A, RNase A, high pressure, Disulfide bond, Endonuclease, Glycation, Glycoprotein, Hydrolase, Nuclease, Secreted
Deposited on 2009-07-09, released 2009-08-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.188
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
    • engineered (105)
  Domains in SCOPe 2.05: d3i7xa_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3i7xA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhaivacegnpyvpvhf
  dasv